PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008220253.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 229aa    MW: 25727.1 Da    PI: 9.6943
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008220253.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.7e-2191150357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  XP_008220253.1  91 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 150
                     7*****************99**************************************97 PP

2Wus_type_Homeobox118.43.1e-3891152465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
     XP_008220253.1  91 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 152
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.18786151IPR001356Homeobox domain
SuperFamilySSF466898.13E-1386156IPR009057Homeodomain-like
SMARTSM003891.2E-788155IPR001356Homeobox domain
CDDcd000869.07E-691152No hitNo description
PfamPF000463.2E-1991150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-892150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGISSMKVHQ FARGLWEHEP SLTLGCTKRL RPLAPKLANT TAGDTTTTAL APFDLKSFIR  60
PESGPRKLGS SDHQEKKDSP HPQVETHPGG TRWNPTQEQI GILEMLYRGG MRTPNAQQIE  120
QITAQLGKYG KIEGKNVFYW FQNHKARERQ KQKRNSLGLS HSPRTPTPVI TNLGEVVGER  180
EEDSPYKRKC RSWGFDCSVE DSVVCKADEV VEGGRGRTLE LFPLHPEGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223910.11e-172hypothetical protein PRUPE_ppa010951mg
RefseqXP_008220253.11e-172PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ6X7J93e-74WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLM5XGN61e-172M5XGN6_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s02540.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.15e-74WUSCHEL related homeobox 4